SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M6UGZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M6UGZ3
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0165
Family Rhodopsin-like 0.014
Further Details:      
 
Domain Number - Region: 60-101
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 0.051
Family Clostridium neurotoxins, "coiled-coil" domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M6UGZ3
Sequence length 196
Comment (tr|M6UGZ3|M6UGZ3_9LEPT) Uncharacterized protein {ECO:0000313|EMBL:EMO44397.1} KW=Complete proteome OX=1049985 OS=Leptospira santarosai str. ZUN179. GN=LEP1GSC187_3823 OC=Bacteria; Spirochaetes; Leptospirales; Leptospiraceae; Leptospira.
Sequence
MATRILLYFSIFFILIGLAFAAYAPDLFQWETLEWIYEKRTFFLFSFIFIVSIVLIYLIY
LKARRGILHSKNKTEIHLEASLNEVIRDNQSLFSFLKSAKDTLGKRIESSKTNFSPEFFS
ACSAQYQKLTQEFDLSEKTFRDIPLILEENEDKKKNGSNFRISEYSDLINRHRKLSRILE
KLREDLTRLRDKVSKV
Download sequence
Identical sequences M6UGZ3
WP_004486382.1.24014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]