SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M7ASI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7ASI2
Domain Number 1 Region: 16-280
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.28e-98
Family Capz beta-1 subunit 0.000000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M7ASI2
Sequence length 291
Comment (tr|M7ASI2|M7ASI2_CHEMY) F-actin-capping protein subunit beta isoforms 1 and 2 {ECO:0000313|EMBL:EMP28306.1} KW=Complete proteome; Reference proteome OX=8469 OS=Chelonia mydas (Green sea-turtle) (Chelonia agassizi). GN=UY3_14587 OC=Chelonioidea; Cheloniidae; Chelonia.
Sequence
MALPGLDIVVIGTIKSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQP
LKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQ
YRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAH
YKLTSTVMLWLQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRS
TLNEIYFGKTKDIVNGLRSIDAIPDNQKYKQLQRELSQVLTQRQIYIQPDN
Download sequence
Identical sequences M7ASI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]