SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M7BBA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7BBA6
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.96e-64
Family Capz alpha-1 subunit 0.00000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M7BBA6
Sequence length 242
Comment (tr|M7BBA6|M7BBA6_CHEMY) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:EMP35236.1} KW=Complete proteome; Reference proteome OX=8469 OS=Chelonia mydas (Green sea-turtle) (Chelonia agassizi). GN=UY3_07610 OC=Chelonioidea; Cheloniidae; Chelonia.
Sequence
MCQEAASLCALHNKLYFTPVMRKECEVLLTRHNELEEKHFLDSQRQVSFKFDHMRKEASE
FQAHPQEDEKGEAWRRALYEGLKAYVSSHYTGGICSVFIKDTAIRKILIACIAGRLHRPS
AFWNGLWKSEWTFTLTPTSTSTQVAGTIMVQAHYFEDGNIHLTVCKDVAESLPVTTETQT
SQDFVKLLEHADNQFQDGLMEEYQRMSNTHLKAFRRQLPITHSTIDWGKIVTAKIVAAPA
VQ
Download sequence
Identical sequences M7BBA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]