SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M7SV77 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7SV77
Domain Number 1 Region: 314-576
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-83
Family Capz alpha-1 subunit 0.00000355
Further Details:      
 
Domain Number 2 Region: 1-191
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.48e-63
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.000000378
Further Details:      
 
Domain Number 3 Region: 187-312
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 5.5e-32
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M7SV77
Sequence length 585
Comment (tr|M7SV77|M7SV77_EUTLA) Putative 2-oxoisovalerate dehydrogenase subunit beta protein {ECO:0000313|EMBL:EMR70494.1} KW=Complete proteome; Reference proteome OX=1287681 OS=(Eutypa armeniacae). GN=UCREL1_2467 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Diatrypaceae; Eutypa.
Sequence
MNLFQAINDALSIALTEDENVLVFGEDVAFGGVFRCTMKLAESFGSDRVFNTPLTEQGIM
GFGIGLAAEGMRPVAEIQFADYVYPAFDQLVNEAAKYRYRDGSCGRNAGGLTVRMPCGGV
GHGALYHSQSPESLFTHIPGLRVIMPRSPLQAKGLLLSAIRSNDPCVFMEPKILYRAAVE
QVPLGSYTLPLSKAEVLKPGKDVTIISYGQPLYTCNTAIQKAEQDLGISIELIDLRTVYP
WDKETVFKSVQKTGRCMVVHESMVNAGIGAEVAAAIQENPETFIRLEAPVARVAGWSIHT
GLLYEKFNIPDVAIESFVEGAPPGELADVVAAQHCAPDIKALTFNEPDIVSQLEPAFEKY
NEEQFVTVKLPGSSQQVIVSSHSSLGGGRYYDVESSSSFAFDHTTQKASDPQSYVLEGSQ
ADLVKSTLKSLSTYAGEHYPNATYGVYPIEDDSKIAIIIVANKYSPNNYWNGRWRSVYIF
DPSSSSLEGSVKVDVHYYEDGNVRLLTNKPVNSSVSSGTGAGIVKEIGVGEKKYQEELNR
GFTSLSEGAFKGLRRQLPVTRQKIEWDKITSYRVGQDIGGGSSRR
Download sequence
Identical sequences M7SV77
XP_007790409.1.6650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]