SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M7TIH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7TIH6
Domain Number 1 Region: 5-262
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.05e-71
Family Capz beta-1 subunit 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M7TIH6
Sequence length 264
Comment (tr|M7TIH6|M7TIH6_EUTLA) Putative f-actin-capping protein subunit beta protein {ECO:0000313|EMBL:EMR69756.1} KW=Complete proteome; Reference proteome OX=1287681 OS=(Eutypa armeniacae). GN=UCREL1_3237 OC=Sordariomycetes; Xylariomycetidae; Xylariales; Diatrypaceae; Eutypa.
Sequence
MASVDPFDSALDLLRRLNPKHTTSHLNNLISLAPDLTEDLLSSVDQPLAVRRCRQTGREY
LLCDYNRDGDSYRSPWSNDATDAPTEKVRRMEVRANEAFDVYRELYYEGGVSSVYFWNLD
DGFAGVVLLKKVATPGTASEGTWDSIHVFEAIDRARFTQYNLTSTVILSLATTGSAAAGQ
GEMDLSGNMTRQIEMELPAETEEQQIANIGRLVEDMELKMRNLLQEVYFGKAKDVVGDLR
SLGSLSEAGRDREAQREIIGSMRR
Download sequence
Identical sequences M7TIH6
XP_007791169.1.6650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]