SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M7ZZ21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M7ZZ21
Domain Number 1 Region: 1-222
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.22e-69
Family Capz beta-1 subunit 0.000000676
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M7ZZ21
Sequence length 265
Comment (tr|M7ZZ21|M7ZZ21_TRIUA) Putative F-actin-capping protein subunit beta {ECO:0000313|EMBL:EMS57615.1, ECO:0000313|EnsemblPlants:TRIUR3_30906-P1} KW=Complete proteome; Reference proteome OX=4572 OS=Triticum urartu (Red wild einkorn) (Crithodium urartu). GN=TRIUR3_30906 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MDLMRRMPPGSTETALNALLSLLPDHSLDLLSQVDLRLQVCMDKENNKEYILCEYNRDTD
SYRSPWSNIYEPPLEDGTVPSEEMRNLEVEANEVFSVYRDQYYEGGISSVYIWEDEDESF
IACFLIKKDGQGKRSYMQIGSWDAIHVIQVGPEEEGAAHYCLNSTVMLSLTTDNKQSGTF
NLSGSIRRQMSMTLAVADGHLVNMGKMIEEMEGKLRNSLDQTHDGCMQAEHSRVLPAAAS
TPARSILGKPGKWFALLGHRLKYLT
Download sequence
Identical sequences M7ZZ21
TRIUR3_30906-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]