SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M8A5G2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M8A5G2
Domain Number 1 Region: 298-445
Classification Level Classification E-value
Superfamily EF-hand 6.78e-45
Family Calmodulin-like 0.0000739
Further Details:      
 
Domain Number 2 Region: 96-272
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.05e-19
Family PsbP-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) M8A5G2
Sequence length 452
Comment (tr|M8A5G2|M8A5G2_TRIUA) Putative calcium-binding protein CML8 {ECO:0000313|EMBL:EMS67612.1, ECO:0000313|EnsemblPlants:TRIUR3_01566-P1} KW=Complete proteome; Reference proteome OX=4572 OS=Triticum urartu (Red wild einkorn) (Crithodium urartu). GN=TRIUR3_01566 OC=Pooideae; Triticodae; Triticeae; Triticinae; Triticum.
Sequence
MAAALLSPASPLPRSSSSAVHPRSKGAAGAAGCAPPSRRRAVSCSCAPDSWSRGLERRQL
VLSGLVSSFAIVLPITVEESCAAATEVDDDGVKMAMLVDETNAYSFLYPVQLPGKKTSFR
WVESRKSERYSSAAPLSQGGEPDKLFAADARQRIVSERLDMINNAVISVSIGPPSSRFLP
SKDKTTWAAKNVADCVLSDKSSLKVTTSQRMAESSVLDAHTEDVDGEPYWYYEYIVRKSP
TKSVGFVHSPFFSLGFLYSLNASTLSKQWESSSYFRGQRQDPSADAATRPGYRRDRGGRK
RLTAQKRKEIKEAFDLFDTDGSGTIDARELNVAMRALGFEMTPEQIQQMIAEVDKDGSGT
IDLDEFIHMMTDKMGERDARDELHKAFRIIDQDGNGKISDMDIQRLAIEAGEHFTLDEVR
EMIQAADENGDGEVDMEEFMKMMKRTGFGTGF
Download sequence
Identical sequences M8A5G2
TRIUR3_01566-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]