SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M8DBJ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M8DBJ7
Domain Number - Region: 14-39
Classification Level Classification E-value
Superfamily LEM domain 0.0471
Family LEM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M8DBJ7
Sequence length 64
Comment (tr|M8DBJ7|M8DBJ7_9BACL) Uncharacterized protein {ECO:0000313|EMBL:EMT50727.1} KW=Complete proteome; Reference proteome OX=1300222 OS=Brevibacillus borstelensis AK1. GN=I532_20481 OC=Brevibacillus.
Sequence
MDLQKGCAGGLTKRTGEGESPVTKLTKGILEQRFFRKEDDAFGVSSSRVEPREILSSLHC
WATV
Download sequence
Identical sequences M8DBJ7
WP_003390607.1.14973 WP_003390607.1.72898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]