SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9LPD0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M9LPD0
Domain Number - Region: 17-64
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 0.00549
Family C-terminal domain of mollusc hemocyanin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9LPD0
Sequence length 66
Comment (tr|M9LPD0|M9LPD0_PAEPP) Cobalamin biosynthesis protein {ECO:0000313|EMBL:GAC42371.1} KW=Complete proteome; Reference proteome OX=1212764 OS=Paenibacillus popilliae ATCC 14706. GN=PPOP_1728 OC=Paenibacillus.
Sequence
MLKLEGNHPFREYHEIIEHGQVVFSGYVNVFGAEQFIDWLNVVRFKREVAKVIPKLEEPP
ADTIYF
Download sequence
Identical sequences M9LPD0
WP_006285795.1.41525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]