SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for M9M558 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9M558
Domain Number 1 Region: 19-167
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-25
Family Capz beta-1 subunit 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9M558
Sequence length 171
Comment (tr|M9M558|M9M558_PSEA3) F-actin capping protein, beta subunit {ECO:0000313|EMBL:GAC75625.1} KW=Complete proteome; Reference proteome OX=1151754 OS=Pseudozyma antarctica (strain T-34) (Yeast) (Candida antarctica). GN=PANT_16d00069 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Moesziomyces.
Sequence
MLIFALLHFGSYLGIAIGQDGGNGVAGAWDSIHVFEATERASGSSRSSSAATGASASYKL
TSTVMLSLVRRDEGDDAADAKATSTRVGTVEIAGSLTRQSEADYALPDFVSHVANVGRMI
EDMEAKMRNQLQEVYFGKTRDVVGQLRSTQSLEKERRARDLQKELMGLWKK
Download sequence
Identical sequences M9M558

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]