SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9U839 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  M9U839
Domain Number - Region: 21-59
Classification Level Classification E-value
Superfamily AF1782-like 0.00458
Family AF1782-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) M9U839
Sequence length 156
Comment (tr|M9U839|M9U839_SULIS) Superfamily I DNA and RNA helicase and helicaseubunit {ECO:0000313|EMBL:AGJ62253.1} KW=Complete proteome OX=1241935 OS=Sulfolobus islandicus LAL14/1. GN=SiL_0798 OC=Sulfolobus.
Sequence
MMEELIKKAEEKGINVEDLIISALSREDPQEGIKLRLTLAEKYMKEAEEYLTKGDVVQSS
EKAYKVAEEIVKAFAEKFNLAEYQQAVKEDRWHTYTLANVAAKLSSRLGDWIKTGWNSAY
TLHVWGFHEAKLDMDSVKNLLQDIKRMLEESKKTLS
Download sequence
Identical sequences M9U839
gi|479325203|ref|YP_007865258.1| WP_015580974.1.91160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]