SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M9XAK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M9XAK9
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily AF1862-like 8.24e-27
Family Cas Cmr5-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) M9XAK9
Sequence length 121
Comment (tr|M9XAK9|M9XAK9_MEIRD) Cmr5 family CRISPR-associated protein {ECO:0000313|EMBL:AGK06317.1} KW=Complete proteome; Reference proteome OX=504728 OS=(Thermus ruber). GN=K649_15155 OC=Meiothermus.
Sequence
MKRALELVSSLEQADPELKRIYGGLCHSFPVMVLQSGLCQAVAFSADKASGEGPRARAHQ
KLLEHLGAILEVEGDLLAHLHQAPTTVYMHHTRRVLEAWVYFKRFAKSVLKVETGGDDEG
R
Download sequence
Identical sequences M9XAK9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]