SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N1QBD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  N1QBD6
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-79
Family Capz alpha-1 subunit 0.00000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N1QBD6
Sequence length 272
Comment (tr|N1QBD6|N1QBD6_PSEFD) Uncharacterized protein {ECO:0000313|EMBL:EME89396.1} KW=Complete proteome; Reference proteome OX=383855 OS=fungus) (Mycosphaerella fijiensis). GN=MYCFIDRAFT_201917 OC=Pseudocercospora.
Sequence
MGSKEATVASFIESAPPGELADVVNDIKALASSQPNLLKSLDSAFKKYNEGQYTTAKLPG
SSDSVIVSEHNVLAGGRYFDSATQTSFAFDHASQKASGAQQHPLESSHADLVRSLLKAFQ
VAAAEHFPSYSIGVYPVDNDSTVALVLVANKYSPQNFWNGRWRSTYLLNPSSNSLSGTVK
ADVHYYEDGNVRMSTSKKLELGSGTGNAESVVREIAKAENKFQEELNRAFVTLAEGSFKS
LRRQLPVTRQRVEWEKIGGYRLGQDIGGGRSR
Download sequence
Identical sequences N1QBD6
XP_007922040.1.3604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]