SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N2A0Y3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N2A0Y3
Domain Number - Region: 198-292
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0392
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N2A0Y3
Sequence length 326
Comment (tr|N2A0Y3|N2A0Y3_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:EMZ19680.1} KW=Complete proteome; Reference proteome OX=97139 OS=Clostridium sp. ASF502. GN=C824_06018 OC=Clostridium.
Sequence
MRKWKGPGKGLGVLLLTAALVCGSVQPVFADGDGADSPSTEVQEKKADGEITPGGDLTGG
TNTNAEAVAAEAAGENKDKKDPGNALSDGENPDAGTTDQKKTDADTPEDDASKKEATEVN
APGTKTNTMEGTEKASSELTKDVKDNDSETKPLAANNGDPVVAVDSVTWEGGLLKVPVDL
GGYTADEILPVLRFAPENTDTYTTLRYPTLEDGYAVYSPISDFYRYRNSVNTFWTEKGSY
DVTMEFHLSDSSEDLICTDAFTLTIPLDSKMWQVEEKVVEFDGSQDITFSFTNGTNYCEL
ESISYVELFLLKGQGGSVSLGNGGFT
Download sequence
Identical sequences N2A0Y3
WP_004076288.1.54735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]