SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N9D7E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9D7E9
Domain Number - Region: 157-226
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0602
Family Capz beta-1 subunit 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N9D7E9
Sequence length 257
Comment (tr|N9D7E9|N9D7E9_ACICA) Uncharacterized protein {ECO:0000313|EMBL:ENV93786.1} KW=Complete proteome OX=1217653 OS=Acinetobacter calcoaceticus ANC 3680. GN=F937_03187 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MKKIILATVIGFSGISSAFAECTYSFDATLTQLQSLGNTSVQKFPTITGNKFSYKTSQQS
PIYAAYSQDYLTRVLAANDNQASLYTRGDKIIPTTGIIAFEYKIKVPTLGNTGYVNIFPT
LAAGIMQNGKAVNFIVAYQHGPTVNNFYIKTTSNDSAVVSDLFNLAPEVTSDGYQKIGIY
INQNSNQVGLVFNGVNKGYFATFPSKLDNLYFSLTSNYFDLAATDANKDVSIEFLLDQSK
ITQTYLTGTKDICGVAL
Download sequence
Identical sequences N9D7E9
WP_005041792.1.66965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]