SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9HJU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9HJU2
Domain Number - Region: 12-52
Classification Level Classification E-value
Superfamily RGC domain-like 0.00759
Family RGC domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) N9HJU2
Sequence length 58
Comment (tr|N9HJU2|N9HJU2_ACILW) Uncharacterized protein {ECO:0000313|EMBL:ENW32105.1} KW=Complete proteome OX=1217668 OS=Acinetobacter lwoffii NIPH 478. GN=F923_00404 OC=Moraxellaceae; Acinetobacter.
Sequence
MMHIKIGQQVKLAQFEHYIFTVTATHQDGSFTVETTLDGQQILSYQNVAQEMLRPVML
Download sequence
Identical sequences N8TTG7 N9HJU2 N9MZS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]