SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for N9UYS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9UYS8
Domain Number - Region: 18-102
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00575
Family Capz beta-1 subunit 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) N9UYS8
Sequence length 124
Comment (tr|N9UYS8|N9UYS8_ENTHI) Uncharacterized protein {ECO:0000313|EMBL:ENY61766.1} KW=Complete proteome OX=885318 OS=Entamoeba histolytica HM-1:IMSS-A. GN=EHI7A_099750 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MQTMELGQFILKQEQERVIDKLTHQDVPVSTEETSKEQIICSSTEDKKNEYVRSVLTKPK
KFEKSKLINPKQKHLKNSLNGPQKLTQQSLDKINKLYFLQKVNRIKEWILTKNDDSDYPY
PFLL
Download sequence
Identical sequences A0A175JWT1 B1N4E8 M2R143 M3TWC0 M7WWB5 N9UYS8
XP_001914064.1.49425 jCVI|EHI_119890 gi|169800958|gb|EDS89160.1| gi|183234685|ref|XP_001914064.1| 294381.B1N4E8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]