SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for N9W6V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  N9W6V7
Domain Number - Region: 232-282
Classification Level Classification E-value
Superfamily TPR-like 0.0503
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number - Region: 129-202
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0575
Family Capz alpha-1 subunit 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) N9W6V7
Sequence length 285
Comment (tr|N9W6V7|N9W6V7_9CLOT) Uncharacterized protein {ECO:0000313|EMBL:ENY98730.1} KW=Complete proteome; Reference proteome OX=999411 OS=Clostridium colicanis 209318. GN=HMPREF1092_03288 OC=Clostridium.
Sequence
MKMGIRTPSLKKSFKARTTGRAKRAIKSSINPAYGKKGMGWIHDPKKAAYNKVYNKTTVS
FGELLDFNIETKAKEEKIVKKATNEFGLIRYYGLTDWWTNELTEVDRNLILESKSNIREE
IYIQEKPGSRYNDENFIEIKDFEFLNDILINMYNEYTTAKKIALKIEELIFRDIEDDYII
SLHFTLTNLMDFYYRNRDKDDSLDRAIFFGYKDIEFSNIFAKEFYSKYGEVMPVNKAYEQ
IGIILERKKKYIEAIRICEKGKSEGWSNDFDKRINRIKSKISKNK
Download sequence
Identical sequences N9W6V7
WP_002599728.1.48006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]