SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O73978 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O73978
Domain Number 1 Region: 8-94
Classification Level Classification E-value
Superfamily Hypothetical protein MTH677 0.00000366
Family Hypothetical protein MTH677 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) O73978
Sequence length 116
Comment (sp|O73978|Y533_PYRHO) Uncharacterized protein PH0533 KW=Complete proteome OX=70601 OS=NBRC 100139 / OT-3). GN=PH0533; OC=Pyrococcus.
Sequence
MRKVIHIGLPKLSEEELIEIGDIAQRVIIDYIFEHLAKSEVRDMEVTARINQGETLDLEL
EVYVEVPIFVRVDVESLIDEAIDKAYEVVERHLRKLAKGKGNEGREEAEEASGKSK
Download sequence
Identical sequences O73978
WP_048053151.1.38245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]