SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for O74232 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O74232
Domain Number 1 Region: 2-256
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.07e-73
Family Capz alpha-1 subunit 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) O74232
Sequence length 262
Comment (sp|O74232|CAPZA_KLULA) F-actin-capping protein subunit alpha KW=Complete proteome; Reference proteome OX=284590 OS=1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica). GN=CAP1; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MSEFEKIVRDIVFDSPPEEISLVYDNLQVLSDGQSKQQIASIIQEFNEKHRVPAAKGEER
YLVSEYNKSGSKYFDPVNKVLFAVDHITREASDIEEYTSEDATQVQSDLYDELSKYVSNF
FPDTAVFNVFKIPESDQYAIIVVSNKKSLGDFWTGYWLSEYVYDVDGDTISGEVSVDAHY
FEDGNVRFKSTASLESAQTDSPIVSIKQFENEFEKNLINKFQYMNETQFKGLRRRLPVTR
AKINWGQGIGNYRLGRDAAQGA
Download sequence
Identical sequences O74232
XP_452130.1.35115 gnl|GLV|KLLA0B13453g 28985.O74232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]