SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P0DJG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0DJG2
Domain Number 1 Region: 25-100
Classification Level Classification E-value
Superfamily Apolipoprotein A-II 2.22e-35
Family Apolipoprotein A-II 0.00000848
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P0DJG2
Sequence length 100
Comment (sp|P0DJG2|APOA2_GORGO) Truncated apolipoprotein A-II KW=Complete proteome; Reference proteome OX=9595 OS=Gorilla gorilla gorilla (Western lowland gorilla). GN=APOA2; OC=Catarrhini; Hominidae; Gorilla.
Sequence
MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAE
AKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
Download sequence
Identical sequences P02652 P0DJG2
9606.ENSP00000356969 NP_001634.1.87134 NP_001634.1.92137 XP_004027815.1.27298 ENSP00000356969 gi|4502149|ref|NP_001634.1| ENSP00000356969 ENSP00000356969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]