SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P13022 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13022
Domain Number 1 Region: 5-270
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.78e-100
Family SCOPe 0.0000000246
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P13022
Sequence length 281
Comment (sp|P13022|CAPZA_DICDI) CAP34 KW=Complete proteome; Reference proteome OX=44689 OS=Dictyostelium discoideum (Slime mold). GN=acpB; OC=Dictyosteliaceae; Dictyostelium.
Sequence
MASNQELVQIATNFLLNAPPCEFMEVVSDVRALLPSESLLNASAGSTFREYNTSQMVSVQ
TSKGSALITKEGEISNNEYLDPKNKQVITYDHIKQEVTGERSASGEIEQDIEQYRAAFDE
EATKYCNEYYPNGVSAVYGTKVSEGIKITVCISTCIYKPNAFYSGRWRSVWTCTFKPGSG
NVTSNGKVQVNVHYFEDGNVQLNTVTQKQTTSPSADAQSTAVNAFKAIGKAELNLHTALD
NNYSTMGDTTFKALRRALPINRTKINWQKVKNFKIANELNK
Download sequence
Identical sequences P13022
4akr_A 4akr_C 44689.DDB_0191243 DDB0191243|DDB_G0272104 XP_645243.1.73096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]