SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P13127 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13127
Domain Number 1 Region: 9-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.68e-158
Family Capz alpha-1 subunit 0.0000000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P13127
Sequence length 286
Comment (sp|P13127|CAZA1_CHICK) CapZ 36/32 KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=CAPZA1; OC=Phasianidae; Phasianinae; Gallus.
Sequence
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences P13127
1izn_A 1izn_C 2kz7_A 3aa0_A 3aa1_A 3aa6_A 3aa7_A 3aaa_A 3aae_A 3aae_C 3aae_E 3aae_G 3aae_I 3lk2_A 3lk3_A 3lk4_1 3lk4_4 3lk4_7 3lk4_A 3lk4_D 3lk4_G 3lk4_J 3lk4_M 3lk4_P 3lk4_S 3lk4_V 3lk4_Y ENSGALP00000002349 NP_990846.1.86415 XP_021233196.1.32913 1iznA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]