SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P13517 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13517
Domain Number 1 Region: 2-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-69
Family Capz beta-1 subunit 0.000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P13517
Sequence length 287
Comment (sp|P13517|CAPZB_YEAST) F-actin-capping protein subunit beta KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=CAP2; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSDAQFDAALDLLRRLNPTTLQENLNNLIELQPNLAQDLLSSVDVPLSTQKDSADSNREY
LCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAPLRKLEILANDSFDVYRDLYYEG
GISSVYLWDLNEEDFNGHDFAGVVLFKKNQSDHSNWDSIHVFEVTTSPSSPDSFNYRVTT
TIILHLDKTKTDQNSHMMLSGNLTRQTEKDIAIDMSRPLDVIFTSHVANLGSLIEDIESQ
MRNLLETVYFEKTRDIFHQTKNAAIASSAEEANKDAQAEVIRGLQSL
Download sequence
Identical sequences A0A0L8VNX8 A6ZVN5 C7GVW2 C8ZAL2 E7QG60 N1P455 P13517
YIL034C tr|A6ZVN5|A6ZVN5_YEAS7 YIL034c___KOG3174 YIL034C YIL034C YIL034C YIL034C YIL034C YIL034C YT178 YIL034C NP_012230.3.97178 YIL034C YIL034C YIL034C YIL034C YIL034C YIL034C YIL034C 4932.YIL034C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]