SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P47754 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47754
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-115
Family Capz alpha-1 subunit 0.000000000445
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P47754
Sequence length 286
Comment (sp|P47754|CAZA2_MOUSE) CapZ alpha-2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Capza2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAIESW
RTSVETALRAYVKEHYPNGVCTVYGKKVDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
VTPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences P47754 Q3T1K5 Q5DQJ3
NP_001009180.1.100692 NP_001009180.1.4139 NP_031630.1.92730 ENSMUSP00000015877 10090.ENSMUSP00000015877 10116.ENSRNOP00000037217 ENSMUSP00000015877 ENSRNOP00000037217 ENSMUSP00000015877 ENSRNOP00000037217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]