SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P47757 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47757
Domain Number 1 Region: 2-266
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.53e-98
Family Capz beta-1 subunit 0.000000000227
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P47757
Sequence length 277
Comment (sp|P47757|CAPZB_MOUSE) CapZ beta KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Capzb; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLRSLDAIPDNHKFKQLQRELSQVLTQRQVYIQPDN
Download sequence
Identical sequences A0A1U7QUC6 A0A250XXL8 P47757
10116.ENSRNOP00000010002 NP_001032850.1.92730 XP_005081112.1.91757 XP_005353005.1.66349 XP_006239239.1.100692 XP_008820056.1.79516 XP_020020974.1.5219 ENSMUSP00000099565 ENSRNOP00000010308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]