SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P52907 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P52907
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.27e-117
Family Capz alpha-1 subunit 0.000000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P52907
Sequence length 286
Comment (sp|P52907|CAZA1_HUMAN) CapZ alpha-1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CAPZA1; OC=Catarrhini; Hominidae; Homo.
Sequence
MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences A0A024R0E5 G2HHJ5 P52907
ENSP00000263168 NP_001267211.1.37143 NP_006126.1.87134 NP_006126.1.92137 XP_003810749.1.60992 gi|5453597|ref|NP_006126.1| 9606.ENSP00000263168 ENSP00000263168 ENSP00000263168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]