SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P70190 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P70190
Domain Number 1 Region: 6-274
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-84
Family Capz alpha-1 subunit 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P70190
Sequence length 299
Comment (sp|P70190|CAZA3_MOUSE) Germ cell-specific protein 3 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Capza3; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSLSVLSRKEKEKVIHRLLVQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYC
VPLCIDGNPVLLSHHNVMGDFRFFDYQSKLSFRFDLLQNQLRDIQSHGIIRNETEYLRSV
VMCALKLYVNDHYPNGNCNVLRKTVKSKEFLIACIEDHSYDNGECWNGLWKSKWIFQVNP
FLTQVTGRIFVQAHFFRCVNLHIEVSKDLKESLEVVNQAQLALSFARLVEEQENKFQAAV
IEELQELSNEALRKILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
Download sequence
Identical sequences P70190
ENSMUSP00000038562 ENSMUSP00000038562 NP_031631.3.92730 10090.ENSMUSP00000038562 ENSMUSP00000038562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]