SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q000R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q000R0
Domain Number 1 Region: 464-481,509-580
Classification Level Classification E-value
Superfamily RING/U-box 3.34e-22
Family Zf-UBP 0.067
Further Details:      
 
Weak hits

Sequence:  Q000R0
Domain Number - Region: 318-393
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0487
Family Canonical RBD 0.038
Further Details:      
 
Domain Number - Region: 614-706
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0497
Family Capz alpha-1 subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q000R0
Sequence length 794
Comment (tr|Q000R0|Q000R0_GIBZA) RING-10 protein {ECO:0000313|EMBL:ABJ55997.1} OX=5518 OS=Gibberella zeae (Wheat head blight fungus) (Fusarium graminearum). GN= OC=Fusarium.
Sequence
MAHYSDNTWRSINQHNCFVSYASSGYLSDTLREVLQYNDFEVSQTPPTPVLTSLVIEFVF
FGPPSKLEVQPKLLTCHLPPVERASLPYGYAMPSYFYHIKFELYPTPDPLTASETEDRKD
IWLPPPESSVFDDFPSHPRPDRQTTYRIPNTPDSPSYNSENHTSPYTTVGQNSSTSSLGI
IDCGTAARPPVKEAERKIEIVSERQWLERANSFPPPNSSAAIHPQNAVRDWRFGRVILET
VDLRTGHTMAGEGSRNTPSAAPSLGPMFGGAGTATKADLLPLETKNTELGWGVVHFYREG
DETPSLVETEGQENGTGDSKSNDCTTLCIPAVPAYMSPGDLMGFVGEKWRGDISHCRMIM
TSRMNRYLVLLKFRDNVRAKQWRREFDGKVFNTMEPQICHVVFVKNITFETPTRRKSSAA
LSPLSSSAGMSSSLRPFPPPTPNLVELPTCPVCLERMDETNGLMTIPCSHVFHCTCLQNW
KGAGCPVCRFTNTSPDANSDPSNPHTQPFGSGASNLCTICGCTDDLWICLICGYVGCGRY
KGGHAKDHWKETAHCFSLELETQHVWDYAGDMWVHRLIRAKGDGKVVELPSRNRSIGHLE
EEDVVPRAKLESIGLEYTHLVTSQLESQRAYYEELISKTVDKASKASATAESAIVQASKA
MEKLALLDEKYTTLSEETIPELERQLERERNKSNKSETLARNLGKSLQEEKRLNEGLMKR
IEHLNNDHEAMAMKLEKVKAENADLQEMNRDLSMFISGQEKLKELENEGKIAEGELEGGS
ASVPEKKSRRRAKR
Download sequence
Identical sequences Q000R0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]