SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q09004 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q09004
Domain Number 1 Region: 49-183
Classification Level Classification E-value
Superfamily Stathmin 3.14e-52
Family Stathmin 0.00000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q09004
Sequence length 185
Comment (sp|Q09004|STMN4_XENLA) Stathmin-like protein B3 OX=8355 OS=Xenopus laevis (African clawed frog). GN=stmn4; OC=Xenopus.
Sequence
MTLAAYKEKVKELPLVSIFCSCFLSDPLKKQTYKYEADTVDLTWCAISDMEVIELNKRAS
GHSFEVILKPPSFDGIPEITATLPQKRDPSLEEIQKKLEAAEERRKYREAELRKHQAEKR
EHEREVILKAIEENNNFSKMAKEKLAQRMEVNKENREAHLAAMLERLQEKDKHAEEVRKN
KEATR
Download sequence
Identical sequences A0A1L8G5Z4 Q09004
gi|147902118|ref|NP_001080837| gi|32450052|gb|AAH54158| gi|397170|gb|CAA50566| gi|586257|sp|Q09004| NP_001080837.1.7800 XP_018119740.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]