SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q09191 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q09191
Domain Number 1 Region: 4-138
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 2.12e-39
Family Eukaryotic RPB5 N-terminal domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 135-209
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 8.05e-29
Family RPB5 0.0000296
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q09191
Sequence length 210
Comment (sp|Q09191|RPAB1_SCHPO) RPC24B KW=Complete proteome; Reference proteome OX=284812 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). GN=rpb5; OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MSAEEKNIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRNLDRTTLSFY
AKPSNDSNKGTIYIEFAKEPSVGIKEMRTFVHTLGDHNHKTGILIYANSMTPSAAKIIAT
VTGQFTIETFQESDLIVNITHHELVPKHILLSPDEKKELLDRYKLRETQLPRIQLADPVA
RYLGLKRGEVVKIVRRSETSGRYNSYRICA
Download sequence
Identical sequences Q09191
SPAC23C4.15___KOG3218 4896.SPAC23C4.15-1 NP_593187.1.19918 SPAC23C4.15 3h0g_E 3h0g_Q 5u0s_e SPAC23C4_15.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]