SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0AM71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0AM71
Domain Number 1 Region: 87-212
Classification Level Classification E-value
Superfamily NosL/MerB-like 1.15e-31
Family MerB-like 0.00047
Further Details:      
 
Domain Number 2 Region: 28-86
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000133
Family MerB N-terminal domain-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0AM71
Sequence length 215
Comment (tr|Q0AM71|Q0AM71_MARMM) Alkylmercury lyase {ECO:0000313|EMBL:ABI66622.1} KW=Complete proteome; Reference proteome OX=394221 OS=Maricaulis maris (strain MCS10). GN=Mmar10_2330 OC=Hyphomonadaceae; Maricaulis.
Sequence
MTDLAQITAVLEAGYIGENPKDLQRASLYIYRALASGKPISIASIAEHLGTPLETASRLL
NLVPPSAIELDDDGHIIGFVGLSLAPTAHRFETAERSLFTWCVFDALFLPSLIEQAATLH
TTCPNSHTDIEIKVTSSSVAAIAPDSPVMSLAKTDTKSCCKDLRGAFCDQVNMFADQSAF
DEWSLDRPNAISVSLSQAFALAQQRNAWRYPDVEY
Download sequence
Identical sequences A0A2D5JX35 Q0AM71
gi|114570880|ref|YP_757560.1| 394221.Mmar10_2330 WP_011644267.1.17043 WP_011644267.1.83773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]