SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0BY68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0BY68
Domain Number - Region: 151-209
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0173
Family Capz alpha-1 subunit 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q0BY68
Sequence length 209
Comment (tr|Q0BY68|Q0BY68_HYPNA) Uncharacterized protein {ECO:0000313|EMBL:ABI76963.1} KW=Complete proteome; Reference proteome OX=228405 OS=Hyphomonas neptunium (strain ATCC 15444). GN=HNE_2897 OC=Hyphomonadaceae; Hyphomonas.
Sequence
MRIKLGKAALSAPDARLCAWIASHYAAPRPINVHFDVIHHGALPRLNIIFDRRGDGASFQ
KKDGMGFNTRKQKRVLKAARELGVLDHLDTALQDKTLVIFTEFENAVREEAAAAITEADV
EAIRSVMPGPAVWLVSRIFGCAIVFFETTSEMKSSAGKRAQEAWRQALQSKSSDYDACRY
FDTEPMQVHFDSRENFEKTYNGNWRAYYN
Download sequence
Identical sequences Q0BY68
gi|114798664|ref|YP_761575.1| 228405.HNE_2897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]