SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0D701 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0D701
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.26e-62
Family Capz alpha-1 subunit 0.0000472
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0D701
Sequence length 215
Comment (tr|Q0D701|Q0D701_ORYSJ) Os07g0414800 protein {ECO:0000313|EMBL:BAF21372.1} KW=Complete proteome; Reference proteome OX=39947 OS=Oryza sativa subsp. japonica (Rice). GN=OSNPB_070414800 OC=Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa.
Sequence
DPRTAQVATVDHIKQKCTKLRPAADEELPSAYIEDFRSALDVELSKYVGEAYPKGVCAVY
CTSGKDIEGPGVDFRFAAVISAAKRSPQNFCNGNWRSIWTLEFIDGLQLVEIKGKIQVGA
HYFEEGNVQLDTNIDCKDSTILQSPEECAVSITNIIRHHESEYLSSLEESYMNLSDATFK
DLRRKLPVTRTLFPWHNTLALSLTRDLTKELAIGK
Download sequence
Identical sequences Q0D701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]