SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0FG36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0FG36
Domain Number 1 Region: 1-193
Classification Level Classification E-value
Superfamily BB2672-like 1.05e-71
Family BB2672-like 0.0000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0FG36
Sequence length 199
Comment (tr|Q0FG36|Q0FG36_9RHOB) Uncharacterized protein {ECO:0000313|EMBL:EAU52803.1} KW=Complete proteome; Reference proteome OX=367336 OS=Rhodobacterales bacterium HTCC2255. GN=OM2255_04725 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales.
Sequence
MHPEIRKIVTYDEEILIEGFRKSEKPWRLFAVAAVIKNPWAGKFVEDLKPEIQAYGPILG
EMMTKRMLKLAGSGDAIEAYGKAAVVGLNGEIEHASALIHTLRFGNFYREAVGAKSYLAF
TNTRAGANAPILVPLMDKNDAGRRSHYLTIQFAISDAPRDDEIVIVLGAAMSGRPHHRIG
DRYQDLKDLGHDLDNPASV
Download sequence
Identical sequences Q0FG36
WP_008034024.1.10404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]