SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0U6W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0U6W1
Domain Number 1 Region: 522-793
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.7e-73
Family Capz alpha-1 subunit 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q0U6W1
Sequence length 801
Comment (tr|Q0U6W1|Q0U6W1_PHANO) Uncharacterized protein {ECO:0000313|EMBL:EAT80316.2} KW=Complete proteome; Reference proteome OX=321614 OS=(Glume blotch fungus) (Parastagonospora nodorum). GN=SNOG_12503 OC=Phaeosphaeriaceae; Parastagonospora.
Sequence
MLMNSPNVNIHGGWNNGDRTAASSSVGSINMLGSEESSSSSDEMDPLDAEDNDDPMMGTP
QAKMGISFPGGIHGSNPSWATNMFSPVAGGIPNFMSIQRARLRKGRSRKSSSSGHSSLAS
PGPASPPNGNVKAESYFAREAAMRKAGSRRESLSLFANDLHISSGNDSGDEAAALPQTPG
VVRRPVVRRGNMLPKSRQFGRIKAELFEESAPVDSEVRREAEIIRQVREADDGPSVTAQS
SPSLLPSAPDLDGPLGGVPELPEEESESNMSLDGSNAKGLFGAFGSLHSNGRGSISSDFW
NSRATQTPPPPTFPRAESSAVSEDMSMDSPTISSSHGFQVPDQSNGMGWASRASTPGPMY
PPTAADGLKKSNKRRRDDDFDETSMKRRAVSPGVSVQNSPIISQSPAQRDTGSWGNANKN
GRETSISGQSNGERSNSGGSMSMTPTLGPKRVGLMGMENAHDGLMKMSIDPALDPSPSAT
DGIDLSSATSPKQRLKLAIATQHRRELFTAHPEYLDMSADKALGSFIESAPPGELADVTK
AIKSILENDNVEAQLAPAYQQYNEEQFTTTKLPGGATEVIVSQYNSLGDGRYYDVETQSS
FDFDHATGKASAVQSYVMESQHEDLMYLHPLLLLTRNPNPPRRKTLIKQLSTHTSEHYPT
SSYAIFPTADASALALLTVANKYSPTNYWNGRWRSSYIYTPSSSTLAGAIKVDVHYYEDG
NVRLLTNKDVSLSGVAEKDVVRRIADVEKKYQEDLNRAFGALSEGAFKGLRRQLPITRQK
IDWDKISGYKLGQDIGGGGRR
Download sequence
Identical sequences Q0U6W1
XP_001802723.1.30160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]