SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q0UUQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q0UUQ6
Domain Number - Region: 143-204
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0418
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0UUQ6
Sequence length 351
Comment (tr|Q0UUQ6|Q0UUQ6_PHANO) Uncharacterized protein {ECO:0000313|EMBL:EAT88268.1} KW=Complete proteome; Reference proteome OX=321614 OS=(Glume blotch fungus) (Parastagonospora nodorum). GN=SNOG_04508 OC=Phaeosphaeriaceae; Parastagonospora.
Sequence
MSWMCLEQLQMGVTHGINKVRLSPEIEGSTVLSTTALDLHKDEAQHLAPDYCGECYGAPS
PTNAIKAGCCNTCDEVRDAYASISWSFGRGEGVEQCEREHYAEHLDQQRQEGCRLEGSIR
VNKVVGNFHIAPGKSFSTGNMHVHDLENYFKDEYSHTFTHKIHHLRFGPQLSNAVIADMQ
KKHQNTGPGGWTSHHINPLDNTEQQTSEKAYNFMYFVKVVSTAYLPLGWEKEAPRLTKHD
ELLGSTIEGNYKGSIETHQYSVTSHKRSLAGGNDEKEGHKERIHAKGGIPGVFFSYDISP
MKVINREVRDKTFSGFLVGLCAVIGGTLTVAAAVDRALYEGVNKIKKIHSQ
Download sequence
Identical sequences Q0UUQ6
XP_001794924.1.30160 SNOT_04508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]