SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q10434 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q10434
Domain Number 1 Region: 3-253
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.09e-70
Family Capz alpha-1 subunit 0.0000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q10434
Sequence length 256
Comment (sp|Q10434|CAPZA_SCHPO) F-actin-capping protein subunit alpha KW=Complete proteome; Reference proteome OX=284812 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). GN=acp1; OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MEKEAIYKLIRESPPGEVNQVVHDIRDIGLSDEEAIHEQLKLYHEDYNSSVSISDDEKVI
ISADNRLEGNRYYDQVLQKSFTINYETMEAENVEDYTEAIKIPDEIVKQIKKVASDHYLS
DVTFGIIKKSDEVESFTIVLVSSKYNPKNYWNGSWRCICNYNVSEKKLEGRSHIRVHYYE
DGNVWLDASRPISATVEETSKLYEVLAQVENGIQQSFNVELSSLNDKKFKELRRQLPVTR
QKINWENVSGIRMRNT
Download sequence
Identical sequences Q10434
NP_594639.1.19918 4896.SPAC12B10.07-1 SPAC12B10_07.1 SPAC12B10.07

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]