SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q11UY8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q11UY8
Domain Number - Region: 52-75
Classification Level Classification E-value
Superfamily An insect antifreeze protein 0.0419
Family An insect antifreeze protein 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q11UY8
Sequence length 131
Comment (tr|Q11UY8|Q11UY8_CYTH3) Uncharacterized protein {ECO:0000313|EMBL:ABG58778.1} KW=Complete proteome; Reference proteome OX=269798 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469). GN=CHU_1507 OC=Cytophaga.
Sequence
MKRLTSILLLVIYFAFNIGLVINKHYCSGKVISVSFSDAKKGMCGICGTKKMNKNCCKDT
QTNLSIDDNQISSHTNFNFIGVYTNAIVPFLSYLIEVPAYSNSIEHTGQFYAFETGPPKI
PIYLRLHTLII
Download sequence
Identical sequences Q11UY8
2005297482 gi|110637911|ref|YP_678118.1| 269798.CHU_1507 WP_011584893.1.19587 WP_011584893.1.79486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]