SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q1WJL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q1WJL6
Domain Number 1 Region: 34-78
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.00000000000000115
Family Myosin S1 fragment, N-terminal domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q1WJL6
Sequence length 94
Comment (tr|Q1WJL6|Q1WJL6_MOUSE) Myosin-7 {ECO:0000313|Ensembl:ENSMUSP00000154569} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Myh7 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MADAEMAAFGAAAPFLRKSEKERLEAQTRPFDLKKDVFVPDDKEEFVKAKIVSREGGKVT
AETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLT
Download sequence
Identical sequences Q1WJL6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]