SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q22D42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q22D42
Domain Number - Region: 67-137
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q22D42
Sequence length 178
Comment (tr|Q22D42|Q22D42_TETTS) Uncharacterized protein {ECO:0000313|EMBL:EAR83211.3} KW=Complete proteome; Reference proteome OX=312017 OS=Tetrahymena thermophila (strain SB210). GN=TTHERM_01002760 OC=Tetrahymena.
Sequence
MQTDDGFIEFQSYNDYQSLQAIFTKARDNNIDLTQQRSKEELIEDYFKYCVKVKINQPMD
VRAHMIKEHYFLVYARIITENSQDHYPSRVYAVVLTDFNNQFCQIQPTYYANESMQARVT
PCFSVNQHLAQKLQSAQLSISKILLYLSDLQTISQKDTNQDTASIKSGSRRNSNDNIC
Download sequence
Identical sequences Q22D42
5911.XP_001030874 3761.m00248 XP_001030874.3.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]