SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q241L9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q241L9
Domain Number - Region: 134-197
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00288
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 
Domain Number - Region: 56-111
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0759
Family Capz alpha-1 subunit 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q241L9
Sequence length 339
Comment (tr|Q241L9|Q241L9_TETTS) Uncharacterized protein {ECO:0000313|EMBL:EAS02551.1} KW=Complete proteome; Reference proteome OX=312017 OS=Tetrahymena thermophila (strain SB210). GN=TTHERM_00630710 OC=Tetrahymena.
Sequence
MNRDLCCNIHKNYPIFHINILENEKTKLQCVKCISYKKIEAEFLLLQDIIEFDSNWFFEN
WPPLSNQQLRNDIIDLKNNETDFNQQIEEFYESLTQEVIQIISQKKKQQLIQAQKVYELK
SDIIEQYQQLAQIDKMKECLVQENQQIEKIEEDLKEQINSQLKKKEEYTSLLSCMMKQYE
LISKLDDIRTAQLKENILEILKVVNLLPQNNFNSSTEKEEFRFENIESYKKKLEEELQIN
KQDQIKVQTLINQLNLCKIELIQKMNQKDWFLDNFLEGQQFLFQNTELEQLIFIKDSYMN
LNEKKKQKENINFKDFRSENIGDMFEIIKYEELNELPNN
Download sequence
Identical sequences Q241L9
3831.m01477 5911.XP_001022796 XP_001022796.1.55412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]