SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q29MS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q29MS7
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.83e-96
Family Capz beta-1 subunit 0.00000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q29MS7
Sequence length 276
Comment (tr|Q29MS7|Q29MS7_DROPS) Uncharacterized protein {ECO:0000313|EMBL:EAL33616.2} KW=Complete proteome; Reference proteome OX=46245 OS=Drosophila pseudoobscura pseudoobscura (Fruit fly). GN=Dpse_GA14356 OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MSEMQMDCALDLMRRLPPQQIEKNLIDLIDLAPDLCEDLLSSVDQPLKIAKDKEHGKDYL
LCDYNRDGDSYRSPWSNSYYPPLEDGQMPSERLRKLEIEANYAFDQYREMYYEGGVSSVY
LWDLDHGFAAVILIKKAGDGSKMIRGCWDSIHVVEVQEKTTGRTAHYKLTSTAMLWLQTN
KQGSGTMNLGGSLTRQTEQDANVTDSSPHIANIGKMVEEMENKIRNTLNEIYFGKTKDIV
NGLRSTQSLADQRQQAAMKQDLAAAILRRNVKPESN
Download sequence
Identical sequences B4G8S8 Q29MS7
XP_001356552.2.19638 XP_002014762.1.64850 XP_017153006.1.22881 FBpp0182882 FBpp0280086 7237.FBpp0280086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]