SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2IBG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2IBG5
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.14e-50
Family Capz alpha-1 subunit 0.00000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2IBG5
Sequence length 117
Comment (tr|Q2IBG5|Q2IBG5_EULMM) Capping protein (Actin filament) muscle Z-line, alpha 2, 3 prime {ECO:0000313|EMBL:ABC87437.1} OX=30603 OS=Eulemur macaco macaco (Black lemur). GN=CAPZA2 OC=Lemuriformes; Lemuridae; Eulemur.
Sequence
NGRWRSEWKFTITPSTTQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEVQTAREFI
KIVEAAENEYQTAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences Q2IBG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]