SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2IBG6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2IBG6
Domain Number 1 Region: 8-72
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 7.46e-20
Family Capz alpha-1 subunit 0.0000394
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2IBG6
Sequence length 73
Comment (tr|Q2IBG6|Q2IBG6_EULMM) Capping protein (Actin filament) muscle Z-line, alpha 2, 5 prime {ECO:0000313|EMBL:ABC87436.1} OX=30603 OS=Eulemur macaco macaco (Black lemur). GN=CAPZA2 OC=Lemuriformes; Lemuridae; Eulemur.
Sequence
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQ
Download sequence
Identical sequences A0A2J8QXG9 A0A2J8UPF5 Q2IBG6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]