SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2TN93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2TN93
Domain Number 1 Region: 70-224
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 2.09e-52
Family Troponin I 0.0000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q2TN93
Sequence length 249
Comment (tr|Q2TN93|Q2TN93_RHIMB) Cardiac troponin I {ECO:0000313|EMBL:AAX69047.1} OX=8386 OS=Rhinella marina (Cane toad) (Bufo marinus). GN=Tnni3 OC=Rhinella.
Sequence
MSDEEEVTYEEEEYIEEEEEEEEEEEPVPEPPKPAPPPPPPVVAPPPLRRKSSANYRSYA
TEPQVKRKPKISASRKLQLKSLMLQIAKSEMEHEEEERAQEKERFLSEHCQPLQLSGLSL
SELQDLCRELHAKIDVVDEERYDMEAKVNKNITEIEDLNQKIFDLRGKFKRPTLRRVRLS
ADAMMRALLGTKHKAAMDLRANLKQVKQVKKDDVDKEIREVGDWRKNVDALSGMEGRKKK
FESSGAVQT
Download sequence
Identical sequences Q2TN93

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]