SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q2V9P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2V9P1
Domain Number 1 Region: 62-81,120-151,285-367
Classification Level Classification E-value
Superfamily OMPA-like 0.000000000889
Family Outer membrane protein 0.034
Further Details:      
 
Weak hits

Sequence:  Q2V9P1
Domain Number - Region: 179-233
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0288
Family Capz alpha-1 subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2V9P1
Sequence length 405
Comment (tr|Q2V9P1|Q2V9P1_ANAMM) OMP4 {ECO:0000313|EMBL:ABB86345.1} OX=234826 OS=Anaplasma marginale (strain St. Maries). GN= OC=Anaplasmataceae; Anaplasma.
Sequence
MRNTLVSHYQHIIEYRRKSLMGVVFVNYARSFLAGTMALSAVCLNFALPSVAQADASDWE
QQDGFYAGFTLNPSYSRVQNFKLKDAGNDPAGILAYHSGIGTVPERFDWNTLDANVEFGN
SSFPALEGIIGFSMQGFRVELGIGREAFPVKTDEAGSSRTFLLIRNLARAVAQHDSDTIE
SELFQHTGGDTQKIKSTVSGIEEMEEALRESVEQRFVDIMQSIQKDPKAEFPRSAVKHLV
AGYGAEKYKYSPKLVAQKIAGLSTQGTASVASSFIRHLEGATVARISGITSTSVTLNVCR
DVPTYIPNARLIPYACAGVGWGFIGMSGETATHLMYRVKGGARYALTPRVHLIAGAFLQG
VFGSVKHQDIDTDVVAGNISKAASHISSTFRLKNLGFNIGASFSI
Download sequence
Identical sequences Q2V9P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]