SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q3KCI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3KCI4
Domain Number 1 Region: 3-317
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.36e-63
Family Phosphate binding protein-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q3KCI4
Sequence length 325
Comment (tr|Q3KCI4|Q3KCI4_PSEPF) Putative ABC transport system, substrate-binding protein {ECO:0000313|EMBL:ABA74521.1} KW=Complete proteome; Reference proteome OX=205922 OS=Pseudomonas fluorescens (strain Pf0-1). GN=Pfl01_2780 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MAKDKIVIGEQNWTGAIAIQHILGEVIKSRLDGDVSYLAGDVPVLFSAAAKGDGSVDVLT
DIWLPNQSAAWAKYVTGGTRSLVPNAHPYAGEQGFYIPGYLQDKYGVKSIYDLKKPEVAK
LFEPVGGGKAELLVGPAGWESTYIGQIKAKDYGFADKFESVSTEASVTYAKLASAYKAQR
GVVFYAYTPDWIFSAYDLRRLEEPAFDGYAQDNKKEDPLYKADGCWKFISPTVDPDWLNK
SHITCAFPDAKVYVLASTALQKRAPKIAEFLHNFSIDPAQLNGLIQKIEKEKQPADVAAK
AWVQANPSTVDQWFAGQAQQVSSAQ
Download sequence
Identical sequences Q3KCI4
gi|77459005|ref|YP_348511.1| 205922.Pfl01_2780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]