SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4C0W8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Q4C0W8
Domain Number - Region: 143-206
Classification Level Classification E-value
Superfamily ERP29 C domain-like 0.00785
Family ERP29 C domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4C0W8
Sequence length 210
Comment (tr|Q4C0W8|Q4C0W8_CROWT) Uncharacterized protein {ECO:0000313|EMBL:EAM49808.1} KW=Complete proteome; Reference proteome OX=165597 OS=Crocosphaera watsonii WH 8501. GN=CwatDRAFT_2660 OC=Aphanothecaceae; Crocosphaera.
Sequence
MDCKATVEIGEYSRGGQTRGYNQAQDHDMGTKEKYVPCGIVDEDTGQLYVTFGSSYKTSD
FMVDNLEQWWTSLSITEKQQLENIQIKVDNGPENSGRRRQFLKRMVEFADQTKKSIQLLY
FPPYHSKYNPIERCWGILERHWNGTLLRNAQTMLAWVKTMTWKGLNPIVKLSKKVYQKGI
SLTKKEMKEIEKRLERNPHLPKWDILIRPS
Download sequence
Identical sequences Q4C0W8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]