SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Q4DAI3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4DAI3
Domain Number 1 Region: 14-308
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.75e-33
Family Capz beta-1 subunit 0.00031
Further Details:      
 
Domain Number 2 Region: 371-399
Classification Level Classification E-value
Superfamily WW domain 0.00000000208
Family WW domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4DAI3
Sequence length 485
Comment (tr|Q4DAI3|Q4DAI3_TRYCC) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:EAN89530.1} KW=Complete proteome; Reference proteome OX=353153 OS=Trypanosoma cruzi (strain CL Brener). GN=Tc00.1047053506363.60 OC=Schizotrypanum.
Sequence
MRESTNKAEDVAAAGASLLARYPPRKGRMILDNIVTLCKHRDAEAVLDIIYREVSPVDTP
WPVLQCPSAATQWLSATPHYFIAFEYNRMGDGYRCPLCNKYVSGDEFVSFPLGNSGLLRQ
MESAANRVFVEYAELYYGKESTASVYTWECDPANKESKMGLAVMIKHRAKSSNGNRPGHF
SLREKRGVWQSAHVGIVDISSGTYYFQSSFYMDSFVPLGSLPNKPDAVGRFNGSVASRLF
SFESREAIATPDLDGLIASIGEQVQLTENSFYGRLFEIYFSKAQFVAEGMRVIPQSTLFL
PPQSRWKEQPAASRVTEESSQQADVHVIGQTSDTNAMTHSGAVRLDYQFAEGSEEIASPL
PKRKESTVVDDWKEAYDDDGNRYYYNEVTGETAWEKPDVGNLVLDILRNLHLMHSPDKYY
RRLKKYFRQYETELNIDTFYSLTNEDQMLELDDGSTMTALEYIVPAYGDRRKIEVYIAQN
ARKDA
Download sequence
Identical sequences Q4DAI3
XP_811381.1.87722 gi|71420148|ref|XP_811381.1| psu|Tc00.1047053506363.60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]